PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000304904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 1025aa    MW: 118611 Da    PI: 6.8789
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000304904genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP73.37.3e-23127185260
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaik 60 
                     g+kdrhsk++T +g+RdRRvRl +++a++++dLq++LG+ ++sk ++WLl +   ++ 
  MDP0000304904 127 FGGKDRHSKVCTIRGLRDRRVRLXVPTAIQLYDLQERLGLNQPSKVVDWLLDDDHNQVR 185
                    689************************************************98776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.4E-21129189IPR005333Transcription factor, TCP
PROSITE profilePS5136923.602129187IPR017887Transcription factor TCP subgroup
SuperFamilySSF747885.23E-110212585IPR016159Cullin repeat-like-containing domain
Gene3DG3DSA:1.20.1310.105.6E-36212347No hitNo description
PfamPF008886.3E-179225848IPR001373Cullin, N-terminal
Gene3DG3DSA:1.20.1310.102.7E-39348464No hitNo description
Gene3DG3DSA:1.20.1310.102.6E-33469593No hitNo description
SuperFamilySSF756321.44E-91589858IPR016158Cullin homology
PROSITE profilePS5006950.306590820IPR016158Cullin homology
Gene3DG3DSA:1.20.1310.108.6E-38594702No hitNo description
SMARTSM001821.7E-74621770IPR016158Cullin homology
Gene3DG3DSA:4.10.1030.102.8E-27707779No hitNo description
Gene3DG3DSA:1.10.10.101.3E-14780847IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.104.7E-16848912IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467856.62E-12860912IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM008849.1E-7872946IPR019559Cullin protein, neddylation domain
PfamPF105572.0E-12875912IPR019559Cullin protein, neddylation domain
Gene3DG3DSA:3.30.420.102.8E-69551017IPR012337Ribonuclease H-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006511Biological Processubiquitin-dependent protein catabolic process
GO:0003676Molecular Functionnucleic acid binding
GO:0031625Molecular Functionubiquitin protein ligase binding
Sequence ? help Back to Top
Protein Sequence    Length: 1025 aa     Download sequence    Send to blast
MGGRDKERER VFXRVREIGG EKRTPQKWGS HPNGNFSAXR EAEFPVEVAN IIEAEDVVGL  60
LGEEYFGFEG GEEHQKHSGG RLWSSXTSRE CVAREANKIS SNPNLSRSST LWPRLKDPRI  120
VRASXAFGGK DRHSKVCTIR GLRDRRVRLX VPTAIQLYDL QERLGLNQPS KVVDWLLDDD  180
HNQVRLLPGF WLHGCELESG RMAMNERKTI DLEQGWEFMQ KGITKLKNIL EGLPEPQFSS  240
EDYMMLYTTI YNMCTQKPPH DYSQQLYDKY RESFEEYITS TVLPSLREKH DEFMLRELVK  300
RWTNHKIMVR WLSRFFHYLD RYFIARRSLP PLNEVGLACF RDLVYQELKP KVRSAVISLI  360
DQEREGEQID RALLKNVLDI FVEIGMGQMD HYENDFEADM LKDTAAYYSR KASNWILEDS  420
CPDYMLKAEE CLKREKDRVS NYLHSSSEPK LLEKVQHELL SVYATQLLEK EHSGCHALLR  480
DDKVDDLSRM FRLFSKIPRG LDPVSQIFKQ HVTAEGTALV KQAEDAASNK KAEKKDVVGL  540
QEQVFVRKVI ELHDKYIAYV NECFQNHTLF HKALKEAFEI FCNKGVAGSS SAELLATFCD  600
NILKKGGSEK LSDEAIEETL EKVVKLLAYI SDKDLFAEFY RKKLARRLLF DKSANDDHER  660
CILTKLKQQC GGQFTSKMDG MVTDLTLAKD NQVGFEEYLR NNPQANPGID LTVTVLTTGF  720
WPSYKTFDLN LPPEMVKCVE LFREFYQTKT KHRKLTWMYS LGTCNIIGKF XPKTIELIVT  780
TYQASALLLF NTSDRLSYSE IMTQLNLTDD DVVRLLHSLS CAKYKILNKE PNTKTISPTD  840
YFEFNDKFTD KMRRIKIPLP PVDEKKKVIE DVDKDRRYAI DASIVRIMKS RKVLGHQQLV  900
MECVEQLGRM FKEAYFRSQC VHLKLHVDDR ISNLSGXVMR DRLRPHFNPR FHRDITLFDE  960
SGDVGGTWEF DFQGFDEEAN PHVAESIALL KANGXDLDKL WKFGIDSEIF VEGFVGSSSS  1020
TEFAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a0k_A1e-12124690769706CULLIN-4A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.77060.0fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE8020750.0HE802075.1 Pyrus x bretschneideri mRNA for CUL1 protein, cultivar YaLi, haplotype S21S34.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008390685.10.0PREDICTED: cullin-1-like
SwissprotQ94AH60.0CUL1_ARATH; Cullin-1
TrEMBLM1WL480.0M1WL48_9R
STRINGPOPTR_0008s22590.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.19e-25plastid transcription factor 1